Kortikotropinfelszabadító hormon

A Wikipédiából, a szabad enciklopédiából
A kortikotropinfelszabadító hormon szerkezete

A kortikotropinfelszabadító hormon (vagy kortikoliberin, angol rövidítéssel CRH) a hipotalamusz által termelt peptidhormon, amelynek elsődleges funkciója, hogy az agyalapi mirigyben stimulálja az adrenokortikotrop hormon (ACTH) szekrécióját. Neurotranszmitterként szerepet játszik a szervezet külső stresszre adott válaszában is.

Termelése[szerkesztés]

A kortikotropinfelszabadító hormon génje emberben a 8. kromoszómán elhelyezkedő CRH,[1] amely egy 196 aminosavból álló prekurzor fehérjét kódol; ennek feldarabolásával keletkezik a 41-aminosavas CRH. Szekvenciáját először W. Vale állapította meg 1981-ben.[2] Vale a birka hormonját szekvenálta meg, annak aminosavsorrendje a következő:

  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

Az ember és a patkány hormonja megegyezik egymással és 7 aminosavban eltér a juhétól:[3]

  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

Funkciói[szerkesztés]

A CRH-t a hipotalamusz paraventrikuláris magja bocsátja ki stressz hatására. Alzheimer-kór vagy depresszió esetén mennyisége megnő.[4] A vérárammal átkerül az agyalapi mirigy elülső lebenyéhez, ahol hatására a kortikotrop sejtek adrenokortikotrop hormont (ACTH-t) és a vele együtt keletkező egyéb hormonhatású vegyületeket (β-endorfint) bocsátanak ki. Az ACTH a mellékvesekéregben stimulálja a kortizol, glukokortikoidok és mineralokortikoidok kiválasztását.[5]

Rövid távon a CRH elnyomja az éhségérzetet és növeli a szorongást. Bár közvetve - a kortizol aktivációjával - elnyomja az immunfunkciókat, önmagában képes erősíteni a gyulladásos folyamatokat.[6] Egyes öngyilkosok gerincvelőfolyadékában extrém magas CRH-szintet mértek.[7] Jelenleg kutatják, hogy a hormon receptorának gátlásával lehet-e kezelni a szorongásos tüneteket.[8] Lehetséges, hogy a hormon receptorának szerepe van az alkoholfogyasztás után mutatkozó eufóriaérzet kialakulásában; kutatják, hogy blokkolásával gyógyítható-e az alkoholizmus.[9][10]

A hipotalamuszon kívül a T-limfocitákban és a méhlepényben is keletkezik CRH. A méhlepényben meghatározza a terhesség tartamát és a szülés megindulásának időpontját; ekkor koncentrációja hirtelen megugrik.[1] Ez a hatása a méhösszehúzódást szabályozó dehidroepiandroszteron és prosztaglandinok mennyiségének növelése révén jöhet létre. Laboratóriumi körülmények között a terhesség során magas koncentrációban jelen levő progeszteron a CRH szintézisét gátolta; a terhesség végén viszont a progeszteron blokkoló hatása véget ér.[11]

A kortikotropinfelszabadító hormon orvosi diagnosztikában használt szintetikus formája a kortikorelin.

Források[szerkesztés]

  1. ^ a b Entrez Gene: CRH corticotropin releasing hormone
  2. (1981. szeptember 1.) „Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin”. Science 213 (4514), 1394–7. o. DOI:10.1126/science.6267699. PMID 6267699.  
  3. (1985. március 1.) „NIH conference. Clinical applications of corticotropin-releasing factor”. Annals of Internal Medicine 102 (3), 344–358. o. DOI:10.7326/0003-4819-102-3-344. PMID 2982307.  
  4. (1995. szeptember 1.) „Corticotropin-releasing hormone mRNA levels in the paraventricular nucleus of patients with Alzheimer's disease and depression”. Am J Psychiatry 152 (9), 1372–6. o. PMID 7653697.  
  5. Corticotrophin-releasing hormone. September 5, 2012. Society for Endocrinology
  6. Paul, William E. (1993. szeptember 1.). „Infectious Diseases and the Immune System”. Scientific American 269 (3), 112. o. DOI:10.1038/scientificamerican0993-90.  
  7. (1989) „Elevated CSF CRF in suicide victims”. Biol. Psychiatry 25 (3), 355–9. o. DOI:10.1016/0006-3223(89)90183-2. PMID 2536563.  
  8. Study of Pexacerfont (BMS-562086) in the Treatment of Outpatients With Generalized Anxiety Disorder. ClinicalTrials.gov, 2008. augusztus 1. (Hozzáférés: 2008. augusztus 3.)
  9. Drug Has Potential To Prevent Alcoholics From Relapsing. Science News. ScienceDaily, 2008. augusztus 2. (Hozzáférés: 2008. augusztus 9.)
  10. (2008. július 1.) „Corticotropin-releasing factor-1 receptor involvement in behavioral neuroadaptation to ethanol: a urocortin1-independent mechanism”. Proc. Natl. Acad. Sci. U.S.A. 105 (26), 9070–5. o. DOI:10.1073/pnas.0710181105. PMID 18591672.  
  11. (1989. április 1.) „Steroids modulate corticotropin-releasing hormone production in human fetal membranes and placenta”. J. Clin. Endocrinol. Metab. 68 (4), 825–30. o. DOI:10.1210/jcem-68-4-825. PMID 2537843.  

Ez a szócikk részben vagy egészben a Corticotropin-releasing hormone című angol Wikipédia-szócikk ezen változatának fordításán alapul. Az eredeti cikk szerkesztőit annak laptörténete sorolja fel.